PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Aqcoe7G306400.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; stem eudicotyledons; Ranunculales; Ranunculaceae; Thalictroideae; Aquilegia
Family HD-ZIP
Protein Properties Length: 202aa    MW: 23943.2 Da    PI: 8.6056
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Aqcoe7G306400.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox581.6e-1889143256
                        T--SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
           Homeobox   2 rkRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56 
                        rk+  +t+eq+  Le+ F++++ ++++++ +LA++l+L+ rqV vWFqNrRa+ k
  Aqcoe7G306400.1.p  89 RKKLVLTHEQVMMLEQNFRQHNVLTQTKKHDLADQLNLQPRQVEVWFQNRRARTK 143
                        677789***********************************************98 PP

2HD-ZIP_I/II102.43.7e-3389177189
        HD-ZIP_I/II   1 ekkrrlskeqvklLEesFeeeekLeperKvelareLglqprqvavWFqnrRARtktkqlEkdyeaLkraydalkeenerLekeveeLre 89 
                        +kk+ l++eqv +LE++F++++ L++++K++la +L+lqprqv+vWFqnrRARtk+kq E d+e+ k+ +++l++en+rL+ e ++Lr+
  Aqcoe7G306400.1.p  89 RKKLVLTHEQVMMLEQNFRQHNVLTQTKKHDLADQLNLQPRQVEVWFQNRRARTKLKQREIDCEFWKTYCESLRDENRRLKIELQDLRS 177
                        6999***********************************************************************************96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466899.84E-1875147IPR009057Homeodomain-like
PROSITE profilePS5007117.05485145IPR001356Homeobox domain
SMARTSM003893.2E-1487149IPR001356Homeobox domain
PfamPF000468.4E-1689143IPR001356Homeobox domain
Gene3DG3DSA:1.10.10.607.8E-1889143IPR009057Homeodomain-like
CDDcd000863.93E-1389146No hitNo description
PROSITE patternPS000270120143IPR017970Homeobox, conserved site
SMARTSM003408.2E-13145188IPR003106Leucine zipper, homeobox-associated
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 202 aa     Download sequence    Send to blast
MEEVKECNIS LGLGLGSSEF LPTLKEYKQQ IMFHLSFPPQ MKEETDNEVQ NFERFSSRTT  60
DDEVENKINS SNVYSNKIHS NKTNKIAIRK KLVLTHEQVM MLEQNFRQHN VLTQTKKHDL  120
ADQLNLQPRQ VEVWFQNRRA RTKLKQREID CEFWKTYCES LRDENRRLKI ELQDLRSRKL  180
GSSAYCVHLP LAMNPSYDKY E*
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1137145RRARTKLKQ
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
SwissprotP466046e-38HAT22_ARATH; Homeobox-leucine zipper protein HAT22
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G37790.15e-39HD-ZIP family protein